PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013377m
Common NameCARUB_v10013377mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 554aa    MW: 61754 Da    PI: 7.7186
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013377mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-16127173148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av  + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Carubv10013377m 127 KGGWTPEEDETLRRAVGTFKGKSWKKIAEFFN-DRTEVQCLHRWQKVL 173
                      688*****************************.************986 PP

2Myb_DNA-binding58.61.4e-18179225148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde++v++v+++G+  W+ Ia+ +  gR +kqc++rw+++l
  Carubv10013377m 179 KGPWTQEEDEKIVELVEKYGPAKWSVIAQSLT-GRIGKQCRERWHNHL 225
                      79*****************************9.*************97 PP

3Myb_DNA-binding52.89e-17231274146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+eE++ l +a++ +G++ W+ Ia+ +  gRt++ +k++w++
  Carubv10013377m 231 KDAWTAEEELALMNAHRIHGNK-WAEIAKVLH-GRTDNAIKNHWNS 274
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.173122173IPR017930Myb domain
SMARTSM007175.4E-14126175IPR001005SANT/Myb domain
PfamPF002499.2E-15127173IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-15128183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-22129185IPR009057Homeodomain-like
CDDcd001672.06E-12130173No hitNo description
PROSITE profilePS5129430.49174229IPR017930Myb domain
SuperFamilySSF466898.44E-32176272IPR009057Homeodomain-like
SMARTSM007175.2E-17178227IPR001005SANT/Myb domain
CDDcd001677.18E-15181225No hitNo description
PfamPF139219.1E-18182240No hitNo description
Gene3DG3DSA:1.10.10.604.1E-27186232IPR009057Homeodomain-like
PROSITE profilePS5129421.104230280IPR017930Myb domain
SMARTSM007172.4E-15230278IPR001005SANT/Myb domain
CDDcd001678.75E-12233276No hitNo description
Gene3DG3DSA:1.10.10.602.3E-22233279IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
QVFSFSLYLS LVQRAKYFSN KVLVFLTFLQ PSSSSAAAGE FVYLYISMSC SLNPAAASPD  60
EMDIQEETGE VKIEGQCVEN KQSTPASCSS LSEGSAESSH KSPPTVASPA TASPAHRRTS  120
GPIRRAKGGW TPEEDETLRR AVGTFKGKSW KKIAEFFNDR TEVQCLHRWQ KVLNPDLIKG  180
PWTQEEDEKI VELVEKYGPA KWSVIAQSLT GRIGKQCRER WHNHLNPDIN KDAWTAEEEL  240
ALMNAHRIHG NKWAEIAKVL HGRTDNAIKN HWNSSLKKKS EFYLSTGRLP PPTTAKHGVP  300
DSVTKRSLSA QKRGSDSVTQ TPSRTTDLKN PDEDGNGQSN SCVPLEERVA ASRMTVVNEY  360
AYSPQCVNPE PLPETGGVAM NGYRLYYKPQ IEYYMASEAD TQRMYGHECG CSPIASPVSF  420
FTPPPCRNEY SNGSAPRSPE SFLREAARTY PNTPSIFRKR RPRVVIPDNN DATKTAEVRK  480
IDQKVDDGKD SSESPVSEEV QNNGSNAYNL SPPYRIRSKR TAVFKSRQLE FISAEEEKAD  540
DEIKSAEKDM LLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-661262795158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-661262795158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0349640.0AY034964.1 Arabidopsis thaliana putative MYB family transcription factor (At3g09370) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297357.10.0hypothetical protein CARUB_v10013377mg, partial
TrEMBLR0HXM60.0R0HXM6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G09370.20.0(Arabidopsis thaliana)
STRINGfgenesh1_pg.C_scaffold_30008390.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.20.0myb domain protein 3r-3